PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0020s0460.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family STAT
Protein Properties Length: 708aa    MW: 79786.1 Da    PI: 5.3712
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0020s0460.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT197.71.1e-612223401119
                    STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikf 87 
                             ldvvllna+ q+v+k++e+vasL+yadsgl+vek++d+e+pLL+s+dG+ef+s+drp kll+Gras+klkisqLsskcdnrLfrik+
  SapurV1A.0020s0460.2.p 222 LDVVLLNAICQAVNKELEIVASLVYADSGLHVEKTSDDEDPLLASCDGIEFASYDRPGKLLHGRASLKLKISQLSSKCDNRLFRIKL 308
                             8************************************************************************************** PP

                    STAT  88 eipklkkypfleavskpirCisrsrntrsssl 119
                             eipk++ y+flea+s+pirCisr rn r+s +
  SapurV1A.0020s0460.2.p 309 EIPKFSGYHFLEAFSHPIRCISRCRNPRTSMT 340
                             **************************997654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.60.120.2001.4E-613152IPR013320Concanavalin A-like lectin/glucanase domain
SuperFamilySSF498993.17E-616165IPR013320Concanavalin A-like lectin/glucanase domain
PfamPF133851.6E-616165No hitNo description
Gene3DG3DSA:3.30.505.101.9E-6601687IPR000980SH2 domain
SuperFamilySSF555503.21E-8602677IPR000980SH2 domain
PROSITE profilePS500019.693608707IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 708 aa     Download sequence    Send to blast
MGSDDNNNNN VINRKDYILL KDFRKEIEVE NEKNFSISFW VYLINSSTAA FPATIIKQVC  60
SDISSNAPFL VLNEKKKMTL FPFLHAHKDT TNFSNSTSME IEFPLENWIH VGCEVVTDML  120
RLHINGEIVG EQPQSFSLDK SLNSNGLRKI TLAGAGVDDG LQGYIHLAEV LPLSFSIKDH  180
YVKDPPLRLS VDLSSTSEID EDSDSIWNIV GGKASCRRIF SLDVVLLNAI CQAVNKELEI  240
VASLVYADSG LHVEKTSDDE DPLLASCDGI EFASYDRPGK LLHGRASLKL KISQLSSKCD  300
NRLFRIKLEI PKFSGYHFLE AFSHPIRCIS RCRNPRTSMT WKRPSSAPDP SNKSQSFGLC  360
NGSLELQHNS IHEIRAGPSS KRIKLGKERT STLGQTDVAC YSDTRTTNQV ANAVETQLAR  420
EAENIEEADN SPSVSDSIEE RLSDFNIMSS SGYLISDVII FKYCLGGMTD RALLLKEVAT  480
SASEEDLFRL ANEVSLYSGC SHHRRQIVIA KRLIEEGTKV WNSISQNNRL IQWENGVFEI  540
EEQFMRITCS STRSFTEQDF ELLRRISGCG EYMAQENFEK IWRWLYPVAF TLTSDSINTI  600
WNSTSPKWIE GFITKEEAEL SLQGPRGLQE PGTFVLRFPT SRSWPHSDAG CLIVTYVGSD  660
YTIHHRLLSL DYIYSCEESE MNGKSLEDML FAEPELSRLG RIVRQRQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2080851e-176AC208085.1 Populus trichocarpa clone JGIACSB05-D05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011045569.10.0PREDICTED: uncharacterized protein LOC105140432 isoform X2
RefseqXP_011045568.10.0PREDICTED: uncharacterized protein LOC105140432 isoform X1
TrEMBLU5FZW00.0U5FZW0_POPTR; Uncharacterized protein
STRINGPOPTR_0011s10360.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.10.0SH2 domain protein B